SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008986513.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008986513.1.60252
Domain Number 1 Region: 173-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000649
Further Details:      
 
Weak hits

Sequence:  XP_008986513.1.60252
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000209
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008986513.1.60252
Sequence length 601
Comment PREDICTED: hypoxia-inducible factor 3-alpha isoform X2 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MRPAAGAARRPRCCTSWRTRYPSHVASAPTWTRPLSCASPSATCACTASAPQLELIGHSI
FDFIHPCDQEELQDALTPQQTLSRRKAEAPPTERCFSLRMKSTLTSRGRTLNLKAATWKV
LHCSGHMRAYKPPAQTSPAGSPSSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLD
MKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDFDAVSKSIHTLLSKGQAVTGQYRFLA
RSGGYLWTQTQATVVSGGRGSQSESIICVHFLISRVEETGVVLSLEQTEQHSRRPIQRGS
PSQKDASNSGGSLDAPGPRILAFLHPPSMSEAALAADPRRFCSPDLRRLLGPILDGASVA
ATPSTPPATRRPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDVAQDADALDLE
MLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPAFEPSLLPRWGSDPR
LSCSSPSRGNPSASSLMAGARKRTLAQSSEGEDEGVELLGVRPPKRCPSPEPGNFLLFPL
SLSFLLTGGPAPGSLQDPSTPLLDLNEPLGLGPSLLSPYSDGDTDQPRGHFQPAAGSGQA
D
Download sequence
Identical sequences F6YAQ5
XP_008986513.1.60252 ENSCJAP00000022135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]