SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008990931.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_008990931.1.60252
Domain Number - Region: 30-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0132
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008990931.1.60252
Sequence length 122
Comment PREDICTED: short coiled-coil protein isoform X3 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MDGSGKEEEEDSTFTNISLADDIDHSARIFYRRPKSLLPKMMNADMDAVDAENQVELEEK
TRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSK
RK
Download sequence
Identical sequences F7GB77
ENSCJAP00000005548 ENSCJAP00000042169 ENSCJAP00000044126 XP_008990931.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]