SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008994892.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008994892.1.60252
Domain Number 1 Region: 128-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008994892.1.60252
Sequence length 298
Comment PREDICTED: LOW QUALITY PROTEIN: max-like protein X [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MTESGASPEDPWVKASPVGAHAGEGRVGRACARGGAGRRGASLLSPKSPMLSLPRGCREV
NSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVTSFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences F7IB12
ENSCJAP00000009223 XP_008994892.1.60252 ENSCJAP00000009201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]