SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_008996983.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008996983.1.60252
Domain Number 1 Region: 275-554
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-71
Family Kelch motif 0.0000249
Further Details:      
 
Domain Number 2 Region: 12-132
Classification Level Classification E-value
Superfamily POZ domain 4.71e-34
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008996983.1.60252
Sequence length 558
Comment PREDICTED: kelch-like protein 23 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSN
YFKAMFTADMKEKFKNKIKLSGIHHDVLEGLVNYAYTSQIEITKRNVQSLLEAADLLQFL
SVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISL
EKFLFILSRKNLSVWKEEAIIEPVIKWTAHDVENRIECLYNLLSYINIDIDPMYLKTALG
LQRSCLLTENKIRSLIYNALNSMHKEISQRSTATMYIIGGYYWHPLSEVHIWDPLTNVWI
QGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWTEGLPMLNARY
YHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITEC
YDPEQNEWREIAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIV
GNLPSAMRSHGCVCVYNI
Download sequence
Identical sequences F7H8G6
XP_008996983.1.60252 ENSCJAP00000012369 ENSCJAP00000012369 ENSCJAP00000012386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]