SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009000980.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009000980.1.60252
Domain Number 1 Region: 132-201
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009000980.1.60252
Sequence length 346
Comment PREDICTED: transcription factor EC isoform X2 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MTLDHQIIPTLKRSQPAVPSGGPLVQHAHTALDSDAGITENPLTKLLTLGKEDDNAQWHM
EDVIEDIIDMESSFKEEGTDSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSLP
MKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTI
LKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGTV
DLGAHVTKQQSHPEQNSVDYCQQLTVSQGPNPELCDQAIAFSDPLSYFTDLSFSAALKEE
QRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSLSSDDGDEL
Download sequence
Identical sequences F7DMG3
ENSCJAP00000009505 ENSCJAP00000009505 XP_002751809.1.60252 XP_009000979.1.60252 XP_009000980.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]