SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009000982.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009000982.1.60252
Domain Number 1 Region: 103-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.23e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009000982.1.60252
Sequence length 317
Comment PREDICTED: transcription factor EC isoform X4 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MTLDHQIIPTLKRSQPAVPSGGPLVQHAHTALDSDAGITENPLTKLLTLGKEDDNAQWHL
SGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERR
RRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLE
QANRRLLLRIQELEIQARTHGLPTLASLGTVDLGAHVTKQQSHPEQNSVDYCQQLTVSQG
PNPELCDQAIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAVS
KESSRRSSLSSDDGDEL
Download sequence
Identical sequences F6Q3Y3
XP_009000982.1.60252 ENSCJAP00000045473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]