SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009009973.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009009973.1.102002
Domain Number 1 Region: 15-153
Classification Level Classification E-value
Superfamily vWA-like 5.72e-26
Family Integrin A (or I) domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009009973.1.102002
Sequence length 167
Comment hypothetical protein HELRODRAFT_166479 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MVAPIAPRSSSSSAPKPCLKRRVCTVQIDLVFIFDISGSVIDEYRKSVSFARHITSGLDI
DSDLVRVASVAFSVNVLSYFLLSRFRGDKEASLKAFDFTNAGGQTNIRSAMEFTASTLFV
QSNGDRPGVPNVVILITDGYANVNELEPGQGADLLKRHKSIQQFNTK
Download sequence
Identical sequences T1EY63
XP_009009973.1.102002 jgi|Helro1|166479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]