SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009010228.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009010228.1.102002
Domain Number - Region: 186-229
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0109
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009010228.1.102002
Sequence length 361
Comment hypothetical protein HELRODRAFT_166765 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MKEYCDRDIFVANCDPNEVIIMTSSTYGRMRVGKCVPFDYLIGCYADVLDQSEARCSGRF
NCSFVPDSEFFKVKPCRIDLVSYMEASYICQPVVSFVALETDEEQDASTIHSSSSSSIVH
YGKNMIKNVKLINKSEKSSNNYYKELKFKNISNAFNNRKNVDSVNKSDKKYKGKRCIDNV
TASDIRERSGYLSACLSMYTWHGTFRCPWIIRAQLGQTVQISMLDFYNGIRNKEKFRRSN
IYNKNDVMLRKENSLQELNAANNKLPFKTIDFNNKLTTDIRKKCYSIAVFQDLMDKNAET
NGNLPTNINQAFHLTSCWIEEQKSKKVIVYTSKSHVVSFYMQNDHDAPHYDKCSSLFYYE
S
Download sequence
Identical sequences T1EYH7
XP_009010228.1.102002 jgi|Helro1|166765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]