SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009010634.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009010634.1.102002
Domain Number 1 Region: 110-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000015
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 35-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000411
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 79-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.023
Further Details:      
 
Domain Number 4 Region: 1-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  XP_009010634.1.102002
Domain Number - Region: 152-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000911
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009010634.1.102002
Sequence length 175
Comment hypothetical protein HELRODRAFT_124998, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
PCLNDAACQTVPSGFYMCHCKLPYSGKHCQTSKEWCLNDTNPCVNGGECVKTAQNYSCLC
PENTYGLNCEMERQCERLQPCQNGGMCRDSASGYVCKCAGSYAGESCQYIDYCLSNPCLN
AGACLSLDKDFFCQCPKPFRGKNCQIKGKYAFNIPCKNDGECQSFEETFYCTCEP
Download sequence
Identical sequences T1EH40
jgi|Helro1|124998 XP_009010634.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]