SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009010649.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009010649.1.102002
Domain Number 1 Region: 278-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000686
Family Galectin (animal S-lectin) 0.078
Further Details:      
 
Domain Number 2 Region: 399-457
Classification Level Classification E-value
Superfamily RING/U-box 0.000000514
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  XP_009010649.1.102002
Domain Number - Region: 95-169
Classification Level Classification E-value
Superfamily ARM repeat 0.0269
Family Armadillo repeat 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009010649.1.102002
Sequence length 477
Comment hypothetical protein HELRODRAFT_91560 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MFHFKSFILLPLSSHTTPNSLQLIQQFADNETSWMLVMEDLVYVIPPEQPLAPVAVSVIV
EECCVPSKELITKLSETLNVNDQGRVPPNVKMNRKMNICILLACLAEKMAGPLSVILLSE
MILSFLFRCIKDQSDPSLTLFALIALEKFTLTGENKCTILDRLKEDNILSGLECHHDNEL
DFRLRQIGFCVRWSLDNLCDNEQNNADAAATTTSPTAVATSPTTATVATSLATTPTAAIT
ATATSPTTATTAVATSPARTSIPTATAPTINVILNHDDGYGIGDDETSIAYDGCRQLIWY
KAKSTKHTQPCWKPGDILGLLLNVDSKEVIFSLNGDCLPPNKLLFTLDTPGGYYAAASFM
SYQQCIFNFGASPFVYPPKIAYKKLNDYGMLTLQQRTILPRHMKMSYLKHISISEDSCTI
CVDHQACIKLEPCAHTGFCEICAEVLENCPLCRQKIEDRVRSDVIKGDGDAVSRDHL
Download sequence
Identical sequences T1G854
jgi|Helro1|91560 XP_009010649.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]