SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009011337.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009011337.1.102002
Domain Number 1 Region: 152-274
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 37-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000682
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 1-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 4 Region: 83-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 119-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000786
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009011337.1.102002
Sequence length 284
Comment hypothetical protein HELRODRAFT_72662, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
CMSSPCGNNGSCIDFHGYFTCSCYEGFVNLQPQQCFDFNECSSASPPCQNNGTCLNTVGS
FQCTCPSDYYGVRCQTYSHPCFSSPCKNGGSCYGYGDSSLDFECICQPGYKDSLCSTEEN
KCESYPCEPFGKCNDLGPSSYTCSCLPGFTSVYGNDTFYECKQNLSSCSPQSWCMNLPGR
YQCICPPGKVGLFCEMEVLLCMSSPCGNNGSCNDIFNNYTCSCYEGFRSDGHQLCVDECS
SFTPACQNNGTCVNTIGSFHCSCPANYYGLHCQIYSWVLLAICV
Download sequence
Identical sequences T1G135
XP_009011337.1.102002 jgi|Helro1|72662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]