SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009011576.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009011576.1.102002
Domain Number 1 Region: 278-478
Classification Level Classification E-value
Superfamily vWA-like 1.59e-36
Family Integrin A (or I) domain 0.0022
Further Details:      
 
Domain Number 2 Region: 123-273
Classification Level Classification E-value
Superfamily vWA-like 9.05e-31
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 85-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000272
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  XP_009011576.1.102002
Domain Number - Region: 19-73
Classification Level Classification E-value
Superfamily vWA-like 0.00289
Family Integrin A (or I) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009011576.1.102002
Sequence length 499
Comment hypothetical protein HELRODRAFT_194961, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MSSNFTATWQEAVRTRVANVKIVGVGQDIDMNELVAVATSAAPSTPQSNVFVASNYTTLS
DQLTNKISSAICAEFHVNELSVMLYPTDFKYCNSTSCMKGQCIEEFGGFSCKCPSTSTGT
YCERDKTRIGIIVYSDDAELSIRMNDYWIMQDLITAFKRVLYKGQKTNTASALNLLYTQA
FTSFNGDRSDVPNVAVIVTDGNSNVNPSSTVDEAIACRLAGIRLVTASIGDSVNPAEINN
IASFPLQFNTFNVSNYTLFDKLVHLVVQATCDSFNECLSNTCQPRGTCVNLFHSYQCRCQ
RFYAGLNCERYCTVRSDVVIVLDVSGSIGYLEDWYNMLISFAREIINGLDVDNDVARVAI
VAYSTDVIKTIYFNQYIGNRTKLLESLNFYHDGGTTNTQAALYTVANSVFDSNRGYRGND
NGVLKSVILLSDGESNVQAENTVPAANNLKRLGARVYSVVVGTDINYAEMERVSSNATLY
TYRMPYVSDVVRVASKLLT
Download sequence
Identical sequences T1FWL8
XP_009011576.1.102002 jgi|Helro1|194961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]