SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009012033.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009012033.1.102002
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily vWA-like 3.34e-42
Family Integrin A (or I) domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009012033.1.102002
Sequence length 189
Comment hypothetical protein HELRODRAFT_135215, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
DIVIILDESTSIVSGSNGNQNWESIKNFAVQIADSFPISTDLTKIGILKFSTSANVNQKI
DLNRYLTNSDLKSAILAFDLVGGETNIADALRNGRNMFSQSLGSRPDAPHIMILLTDGQA
NREAEKTIIEANMTKAANIIIYTIGVTSQIDENQLKNIATAPSDSHYFYVTEYSKLDSII
TDLVAQSCK
Download sequence
Identical sequences T1EI74
jgi|Helro1|135215 XP_009012033.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]