SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009012496.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009012496.1.102002
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily POZ domain 1.14e-30
Family BTB/POZ domain 0.0044
Further Details:      
 
Domain Number 2 Region: 426-571
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-30
Family Kelch motif 0.001
Further Details:      
 
Domain Number 3 Region: 294-411
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-18
Family Kelch motif 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009012496.1.102002
Sequence length 572
Comment hypothetical protein HELRODRAFT_168385 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MKKYVSAKYQHKVLRNLYKNFENGSFCDLTIVCKDASFKVHKLVLASSCDFFSSMFQFNF
NENKSNTIDLSHSKASIIRAVIKFVYTGSVKLTEDNVQDLLIVADQYGLSDLFKICTKFL
EKNIYASNVIGMHMLAEQLNCINLKNHSFKYMKNNFSDVVKSDEFLSMPLNLFINYISAP
DLSICTEIEVFEAGLAWICHDLKERESSAEEVMKTMRISVLPYPVVNDKLQFCSSIIVKN
YLGKVISEMLNGDYGKSICRSNRLMIECPINRLSASPRIYFMELIYSPIRCNRSSSMMYY
DVRRNEMKTIPLIKQQSDDTEQLIAAVDRRIYFFGGFGNLKTIEMLDTYENQHKTLGPWP
RRRSFGAACSVGNEIYLIGGLHETDNFHSDIDIFNTWTKKWRVLPFPREYTSTQHLGVVY
WKVFIEIKGLIYIIGGENGEQEAVSQCLIFNPITEKFDDMPNLLTPRSRFGISCYKDHIY
VAGGFDHDSNILCTIERYFIERGHWEKVNSLNVSRYMPTMVTVLDKLYILGGNTSLSYSS
SAIFEVYDPQKNKCSKIEPLLPLLMHPCAIAI
Download sequence
Identical sequences T1F0I7
jgi|Helro1|168385 XP_009012496.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]