SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009012738.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009012738.1.102002
Domain Number 1 Region: 191-387
Classification Level Classification E-value
Superfamily vWA-like 3.76e-46
Family Integrin A (or I) domain 0.00053
Further Details:      
 
Domain Number 2 Region: 2-175
Classification Level Classification E-value
Superfamily vWA-like 9.2e-41
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 446-561
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000253
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 4 Region: 550-650
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000458
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 5 Region: 815-919
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000314
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number 6 Region: 645-747
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000827
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 7 Region: 718-817
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000538
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 887-1006
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000058
Family Growth factor receptor domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009012738.1.102002
Sequence length 1053
Comment hypothetical protein HELRODRAFT_168627, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MKDVAILMDTSGSIVTGQQISPFRAMRRFAKNLIGRLESGWDSQAVVHFSEKAEVVFNFT
TFSTKEEMYQAIDNILQFNENTDTAMGLRTLRQVTFAKGNGERDWVPNIAIVITDGRSNV
EISQTYPEAQLLKNMNVTIYTIGVTNDISPDELKAIASSPDYFIPAEDFNTLGQLSFLDS
VVKASCRSNTAPPDCSSPVDITFILDQSSSIVASGDQDFWYRDLLGFVSSVIKNFNVSPN
GTRVAVVKFSNNANVPILLNNYTSISTLLPAIRNEMIEGGQTNIASGLRAARTNVYNPGR
GYRPNVVNVAFLITDGESNIEMDQTIPEANNLKNLGIELFVMGVGTGVNINELQRIASRP
LDDHLFNAAQYPSLDSVWRKVARNICNAKGEPKVTTAATTATTTTASIPQCSVTNCQQCS
TPNRCSQCNSGYLLDNNGNCILLPITCNVPNCISCQTNNYCSQCENGYFLNNGRCTPQCN
VPNCQQCSMPNRCSQCNSGYNLNGNGECILPPITCNVANCISCQTTNYCSQCQNGFFLSN
GMCLPQCNVQFCQVCLGPNQCNTCMNGYVLNSLNICVLSCFIPHCTFCQIPNFCAQCDAG
YYIVNNGTCVLLPIQCNVLNCQQCLTSNRCAQCNSGFSLDNNGNCILQCSVPNCQQCSTP
NRCSLCYSGYNLDNNGNCIPQCNVPNCQQCLTPNQCNLCNSGYNLNAPNSCVPQCNVPNC
QRCSEPNKCSQCFGNFVLENGSCREAQISCNIVNCITCLQANLCNQCLDGYILENNICRI
RCEVLNCYLCNRPSVCAVCNSGYNLNTLNNRCDVQCNVLNCAVCNSPNVCAACNSGYNLN
LAINRCDLQCNVPNCLICQSASRCLQCSGGYNLDSSSGTCVVQCQVTNCYVCNSANVCGQ
CSPGYNLNVASNRCDPQCNVANCAYCSAPNVCSGCNPGYNLNSASNRCDPQCNVQYCTQC
LTPNQCYLCNNGYYVDNTGQCSPTCRLDYCLICLSSSVCTRCYDSYFWNTALSPPTCAFC
PIPNCDRCLTTTTCDSCRSGYDWSTLVQPPACI
Download sequence
Identical sequences T1F0T3
jgi|Helro1|168627 XP_009012738.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]