SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009013171.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009013171.1.102002
Domain Number 1 Region: 7-295
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 4.36e-17
Family Serum paraoxonase/arylesterase 1, PON1 0.000048
Further Details:      
 
Domain Number 2 Region: 530-575
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000111
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 3 Region: 436-499
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000208
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 4 Region: 356-430
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000112
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 5 Region: 611-658
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000735
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 6 Region: 721-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009013171.1.102002
Sequence length 773
Comment hypothetical protein HELRODRAFT_169093 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MKEFGSEDIKLLPGGKAFVSSGFKLSNDGRKNSVGGIYLFDFNKPSEKPLNLLMVDERGQ
QLPITPHGLSFWTDAASGVTYLYVVNHHNGVESIEKFRYHPEEKKLVRVKQFKDETFHVL
NSIHLVGEDQFYFTNYLFFNAYFELFFGLEWGSVGYFNGEHGELVVKGLNIPNGVIMWKN
HLVVALSGSDELNVYSVAKDHQLNLERTIPVKTSVDNLSVHPEHDDLILGCHPSPFKFPF
HSRNPDAYLSPSQVLRVNDKSEVTEIYSNDGSELSASTVAVLYKDAMLIGSAYTKLLYCQ
DKTLPQYNVTQLYTTQCDTKSYNTAYHHTTSSQHYTTLHHTYTRWNGKSSDIRDPCLGRN
CSFGAKCVASLDGMSARCQCREVCYNYGDSEGSTPICGSDGVDYANTCEMERTACRDMKD
VKKKFDGKCDPCREIKCPISQVCKLDSKRQPVCRCFNPCPNNYSPVCANNGKTYVNKCFM
DLDACKLSKNLVVISKENCSYENSLCDKKKECDYYADCYNTPKGLTKCICPEWCDKIVKP
VCGSDGLTYDNICEMKRRSCLSKHWIRLVEYGMCSKDSENNYRDLGLLTNYCEQFGCQPG
AECVVGEDGVECFCANCSSHVTDEVCGTDGRSYRNVCEMKKYSCVNKKTVHVGHAGPCGQ
NLNCKQSKFGCCSDDGRFESQGPNEEGCPNVKIGKYKVKYEPKWNGLASIQLDIFLFHEQ
CQCNTFGSVGAQCGAATHACSCKPGVGGIRCDRCVPTYWGFSGILDAQDGCLR
Download sequence
Identical sequences T1F1D8
jgi|Helro1|169093 XP_009013171.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]