SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009013855.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009013855.1.102002
Domain Number 1 Region: 110-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-69
Family Thrombospondin C-terminal domain 0.000002
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.8e-26
Family TSP type-3 repeat 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009013855.1.102002
Sequence length 302
Comment hypothetical protein HELRODRAFT_75607, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
DSDHNAVGDECDSEIDRDDDGVIDDIDNCERIYNPDQANNDDDIYGDACDNDDDNDGIID
TEDNCPLVPNKDQMDSDGDGVGDVCKLDSDGDGIFDSEDMCPYNNRISATDFSKLQTINL
DPVGTNQLDPEWVVKNNGSEILQSLNSDPGVALGVHYFGGLDFSGTFFINTEDDDDYAGF
VFGYRNDRRFYVVMWKKEHQTYWKQEPFRAVGDAGVQIKVVHSIEGPGEMMRNSLWHREG
KEDESRNLFNDENKIGWQAKTSYRWELMHRPSIGLIRFRHLFTFLLFYYFLLLLFYWFFV
LI
Download sequence
Identical sequences T1G272
XP_009013855.1.102002 jgi|Helro1|75607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]