SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009015004.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009015004.1.102002
Domain Number - Region: 95-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0144
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009015004.1.102002
Sequence length 528
Comment hypothetical protein HELRODRAFT_191240 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MYVKKVQQYCFPWHFNASCGPDEMIMMTSAMYGRSSKGRCSGRRSCHVVTPDPILYQLKP
CPNDFSVSLEADYSCVKVEMGKPYTCNHFGDPQIVNEPRGYLASLVVEELKIGGPRCPWM
ITASRGQQINFTLHDYGVALRRDDVISIQTMASPQSLIRHENELHLLQAYHDARHRTRRN
QLEHAPSCKVYVTLRDVEARSANSAIIDVADCTSKERIRHVMLSEGPKVEVTMMDLKVKE
EIIYYALHFEAVGCADPIVPRGAHLRRNGIQATITCNFTIQSWHIVCQGDGWYGSVDNCT
VETPTKSSMVLNDSTEIYPLDYKNKGGGTIKAGSTSVDALGHVEVVVPNDLEGGGLSLLV
AVMVGLVLGVLIGVVLLTLVLSCHKKLYSKKRLREAKELSSQRVLYSTRRDVINDNDDDN
YNADSNNINNYAPTTTSTPNYHHLHTNNNNTNNNTTSTTTYCPSYHYSPGNGFGSTGSTL
LAGRNYLDFQDGIRYTHVCGLGAMDVVPPCERNESNNNNVCNDNRQAS
Download sequence
Identical sequences T1FSS2
XP_009015004.1.102002 jgi|Helro1|191240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]