SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009015298.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009015298.1.102002
Domain Number 1 Region: 83-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000111
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 46-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000165
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 121-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000269
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 9-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000231
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009015298.1.102002
Sequence length 159
Comment hypothetical protein HELRODRAFT_144286, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
VIFIIILAKPCSPSKCRNNATCLPKLQVTYSCACLANFIGRNCEYVDPCIKKPCKNGGSC
HAIGLFYRCLCPPGFAGHYCQMVDQCVSNPCQNGGTCTKHRRGYKCQCATGYTGDTCERI
CPCSSNPCENGGTCISKGDSFVCKCPPFFAGFTCTTGQL
Download sequence
Identical sequences T1EJE0
XP_009015298.1.102002 jgi|Helro1|144286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]