SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009015863.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009015863.1.102002
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 38-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000304
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 130-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000451
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 84-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000447
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009015863.1.102002
Sequence length 168
Comment hypothetical protein HELRODRAFT_64941, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
NECSSSPCTNGGTCVDHIYYYKCTCPTGFTGTNCQYSIYPCRSNPCQNNGTCNDLSDLKA
SPAISNYTCSCIAGYNGSNCEFYWNKCLNNPCAYGGTCSVVKNLGPPESYSYKCSCVTGA
TGANCETALVNKCDSSPCKNGASCENKVTSFACTCVAGYVGITCESGW
Download sequence
Identical sequences T1FY17
XP_009015863.1.102002 jgi|Helro1|64941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]