SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009017518.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009017518.1.102002
Domain Number 1 Region: 3-77
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000471
Family Kelch motif 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009017518.1.102002
Sequence length 161
Comment hypothetical protein HELRODRAFT_172605 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MAQLLNKRLNHIMISTNNKLIVIGGVIHDAESSTWPDVMSGEVYDCEANQWTYLLTLMKP
VFNFAFFTMNNCLYIMGENKSSHNCSINPFIQKINLSTYLEINNTSGNTVGNINNDVNKI
NHNKVNHNNKGDGCQILNYNAERSLIYHVFGTMISSKQFLK
Download sequence
Identical sequences T1F5L8
jgi|Helro1|172605 XP_009017518.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]