SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009019352.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009019352.1.102002
Domain Number 1 Region: 7-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-67
Family Lectin leg-like 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009019352.1.102002
Sequence length 304
Comment hypothetical protein HELRODRAFT_65456 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MRCDNSYQVREHSLIKPYNDDRWDFTGSTIISSTAVRLTSDYQGQRGAIWNNIPCRLRNW
EMHVHFKVDGKGSELFGDGFAIWYTKEKMEMGPVFGNRDKFTGLAIFFDTYANQNGAHNH
GHPYVSAMINNGTLSYDHDRDGTHTELSGCESNFRKSRFETFAAIRYEKNKLTVSLDISG
RNEWKLCFTTSNVHLPTEYFFGATAATGDLSDNHEIMSIKVFDISEGKVVTEDDADYSNV
VPNAEYFAPPRDHVDDPKLSTLSRLTGWKLVGVFVLAAVGIIVCLMIGYILFNKTQQTSR
KRLY
Download sequence
Identical sequences T1FY79
jgi|Helro1|65456 XP_009019352.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]