SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009020668.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009020668.1.102002
Domain Number 1 Region: 101-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.009
Further Details:      
 
Domain Number 2 Region: 60-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  XP_009020668.1.102002
Domain Number - Region: 22-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00243
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 147-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0255
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 218-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0269
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 189-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009020668.1.102002
Sequence length 303
Comment hypothetical protein HELRODRAFT_192336 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MNEPLRCSCPADRYGRHCDFFNSCSSTPCLATRNCSLIDPSYTCPCTINSGNSRCETFAT
PCPSTSNICSNQGSCYINASSLSSYCVCSPGFSGVSCNVVVDPCSSNPCLNGGQCKGVDR
KVDPTGRTCFCTVGFVGETCQLSVQSVCASNPCQFNSICSGLYDPVAKNLSYNCTCGQYL
EGMNCGNCTYCLNGGKCYVEAGQLKCSCSSAGKFGVRCNETDPCASAPCPAGSICQSSAD
GRYACSNNVPLAAVTSTSKQQNRSSSSCNNNITSRNCSSRNKNDNSSYDNNDKNGGRYTN
NNN
Download sequence
Identical sequences T1FTU2
jgi|Helro1|192336 XP_009020668.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]