SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009021801.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009021801.1.102002
Domain Number 1 Region: 128-298
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000000216
Family Serum paraoxonase/arylesterase 1, PON1 0.089
Further Details:      
 
Domain Number 2 Region: 23-166
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000256
Family WD40-repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009021801.1.102002
Sequence length 305
Comment hypothetical protein HELRODRAFT_176332 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MAIMAKLIFSIVTLVILSVFVTAEKPQLLATFSNGTPVYGLAVLKNNLIAVSRENSGKLQ
LYNVAINGLFTELNSVDMARSDSYYDMAYLNKSEQFVLLNWLDSNKIILMQSRFPYEVKS
WNFTSDTTMASLAVTESDQTIIVTEGMSKQVKIYDPSGKLLRTIKLQMARSPRQAIRLSN
NLYAVTAGYETTESHLVCRFNVKGYVVGRCFGGRPGNSINQLNVPARMVLLNDGSVLLAD
MKNSRILKLNKDLSSAEIFLGASDGIHQPYRLYADESKRILYVADNTLDPVTSYAVSGRV
IAFRY
Download sequence
Identical sequences T1FAE4
XP_009021801.1.102002 jgi|Helro1|176332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]