SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009026025.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009026025.1.102002
Domain Number 1 Region: 220-346
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.55e-19
Family I/LWEQ domain 0.00035
Further Details:      
 
Domain Number 2 Region: 48-136
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.62e-17
Family A middle domain of Talin 1 0.00093
Further Details:      
 
Domain Number 3 Region: 151-243
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000288
Family I/LWEQ domain 0.00097
Further Details:      
 
Weak hits

Sequence:  XP_009026025.1.102002
Domain Number - Region: 596-659
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00785
Family I/LWEQ domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009026025.1.102002
Sequence length 713
Comment hypothetical protein HELRODRAFT_178918 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MRSQMSAMNQAVARIINLMTSPSRHPHTPPPHHHYRPVEAGEDVDRDSSLDCVAVGSAIQ
AISSNICGFSRHIHELAASMSGDEVEDGSKLLEAARKLVDAFNALLSNLQPHCDQSKHDM
LNFASQIGETSEKLISLIERSHVAADAAGIDDSYKNTLLNLSQAVAMATNVLMMKVKGVA
CERTNQSEQRDIISCATNCAHRTSQLVACAKESCAMNDVTKHELDEAANQVMLCVQQLID
HVTTSSLRCRQHYTNKAFDKANKVAVIVRTTDELCMNINNTQVMIQQARLLAMATSQLVN
ALKLEAEEEEKMKRKNSEEHHKLLTAAKELADATTKMVEAAKISLRRLTTRTTQMMNTCA
GIGRYNRDVRMQQQLLNICKMISSNNILQAVQSLRTSVVTINNISSSCCNNVDEVETQQA
ILADLVNTSKCMLNPCEQLLSAALATAATIMEESAVHHLSCSADQLTEAMQLLKEDVEKC
SSILSLTSDPMDLYLQTINQAQHELRTFKSCLRAFEVEKDCDGEKEERDSEEMKRERQVW
FNKLGTSSKNVGSCMARMLTHAIQGRTSETHQSTDESISSLISLTNSVKGIVECSPHDVT
LQEAVMDLGSDVLEKSKNLIIEAKLALKECAGTDRQTKLVSVAKSLSHALSQLISCVPGV
KQVDDVIRYISNYNVTIHQQVDRIVVINNYDHTSLPLNQYLLSKPETRIQQSL
Download sequence
Identical sequences T1FDW4
XP_009026025.1.102002 jgi|Helro1|178918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]