SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009026139.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009026139.1.102002
Domain Number 1 Region: 127-305,383-451
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000177
Family SGL-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009026139.1.102002
Sequence length 459
Comment hypothetical protein HELRODRAFT_179042 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MACDVEIVPYTYDFVAEEVFCYVVIRVEFAQLAIKIIWGQPSFNNRKYFRSGFIKFKRSG
FIVVGDDLKIFEVASKIISSSAAEGYTDLRITKTAEIPQQSNPGQSVVLVRTISLDKEIR
GVTAIRNQLFVVTANSPLLYSFNIDTYDLITTFNVKDVKNPFDLVSNGSDVLFISEWSML
NIHRVEFPSKKVSHITTSNPYSTLSINYNNNSLLAVSKNKNKISEYKMFGSKKKIKSVLL
NINSSAPYGKSSHYGSVAHAINLTYNSEVCEDSKYLVCSTDNHLHIVDRKGSIQWSYNSH
VKHVKLSKSDVDDEGKYNKSYLSSPPQTKSSSSSSSSSSSNFTKDLLETKSNKSNNTSNN
DDNKIDNLIDNNNLDGNRKLISHCLNKPSHLTTDKNGFILVCDSGNDRVLLLNKCLEFVR
ELIEPGINGMKNPLRIFLDDARSRLYVVAGDLFVYQLIY
Download sequence
Identical sequences T1FE33
XP_009026139.1.102002 jgi|Helro1|179042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]