SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009026518.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009026518.1.102002
Domain Number 1 Region: 128-395
Classification Level Classification E-value
Superfamily vWA-like 4.23e-87
Family Trunk domain of Sec23/24 0.00000121
Further Details:      
 
Domain Number 2 Region: 8-66,413-522
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.36e-68
Family beta-sandwich domain of Sec23/24 0.00011
Further Details:      
 
Domain Number 3 Region: 626-766
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.28e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000481
Further Details:      
 
Domain Number 4 Region: 523-625
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.45e-46
Family Helical domain of Sec23/24 0.00000924
Further Details:      
 
Domain Number 5 Region: 49-122
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 9.16e-22
Family Zn-finger domain of Sec23/24 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009026518.1.102002
Sequence length 770
Comment hypothetical protein HELRODRAFT_185982 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MSTYQEFIQQNEDRDGIRFSWNVWPSSRLEATRLVVPLGCLYTPLKERPDLPPIQYDPVL
CTRAICRAVLNPFCQVDYRAKVWTCNFCFQRNSFPPQYSAISEQHQPAELVPHFSTLEYT
LTRVQCHPPIFLIVLDTCMEDEDLQAVKESLQMSLSLLPPNALVGLITFGKMVQIHELGC
EGYSKSYVFKGTKDFTAKQVQELLGIGKGHMGPHAHRPSNPQQGQQQLPYSRFLQPLHKC
DMALTDLLGELQRDPWPVAQGKRPLRSTGVAASIAVGLLECTYPNTGARIMIFMGGACTQ
GPGQVLGDELKYPIRSHHDIEKDNCKYMKKAMKHYESLAHRACNNGHVVDIYACALDQTG
LLEMKYLPTLTGGHMVMGDSFNTSLFKQTFQRVFAKDSKNEFKMAFAANIEVKTSKELKV
QGCIGSCTSMSNKTGTNISETEVGVGGTCQWRMCGLYPNTTYAFFFEVANQHNAPIPQGG
RGYIQFITQYQHSSGQRRIRVTTLARNWFDAAVNIQNIAAGFDQDAAAVLMARIAAFRAE
TDEGPDVLRWLDRMLIRLCQKFGEFNKDDPNSFVLSQQFTLYPQFMFHLRRSQFLQVFNN
SPDETTYYRHMLMVEDIQQNLIMIQPIIYAYSFNGPPEPVLLDTSSILPDRILLMDTFFQ
ILIYHGETIAQWRKAGYQDLPEYQNFKQLLQAPVDDAQDILQTRFPMPRYIDTESGGSQA
RFLLSRVNPSQTHNNMYSYGQEGGGHVLTDDVSLQVFMEHLKKLAVSSNS
Download sequence
Identical sequences T1FNI6
XP_009026518.1.102002 jgi|Helro1|185982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]