SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009028982.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009028982.1.102002
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-45
Family Kelch motif 0.00013
Further Details:      
 
Weak hits

Sequence:  XP_009028982.1.102002
Domain Number - Region: 259-286
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.0498
Family Vertebrate phospholipase A2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009028982.1.102002
Sequence length 291
Comment hypothetical protein HELRODRAFT_108080 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MEYKTCMVDNCLYVAGGNRYTSLVTNEVYVYKPVPAIWTKCCSMYVPRKDFYFGELDGHL
YAVSGRTFITRTPTVEKYIPQKNRWAMLAPLPVDSSRPAGCACNGLLYLSGGLTESGTSN
RVWRYNPDLNNWTEMARMLSSRAEHIMTCIGNKVFAIGGSICEYQFFAWNDVMSGEIYDC
EANQWTNLLTLKMSVLNKAFFTSDNCIYIIGQELNFRHHFFNTFVQKINLRMYLDKITAS
GNHDSNTNDAASNAAGNNNNDDGCQVFRCEVNNRLDYCFFGIVNSSKLASE
Download sequence
Identical sequences T1EEF1
XP_009028982.1.102002 jgi|Helro1|108080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]