SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009029885.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009029885.1.102002
Domain Number 1 Region: 153-350
Classification Level Classification E-value
Superfamily vWA-like 4.17e-46
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 355-580
Classification Level Classification E-value
Superfamily vWA-like 3.81e-38
Family Integrin A (or I) domain 0.0028
Further Details:      
 
Domain Number 3 Region: 6-123
Classification Level Classification E-value
Superfamily vWA-like 6.52e-23
Family Integrin A (or I) domain 0.0045
Further Details:      
 
Domain Number 4 Region: 124-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009029885.1.102002
Sequence length 582
Comment hypothetical protein HELRODRAFT_104083 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MIEAVNVPFTSGDTNTADAIFLARTQLFNQLHGDRPNSPNILILLTDGMSSNSTATWQES
SRARASGINIITVGVGQDIDMNELIAVATSTAPSSPQSNVFVASNYSTLSTQLTNNLSSA
ICSDFRHCNASSCQFRGQCVEEFGGFSCRCTTGYTGIYCERGCSGQLDLMIVVDLSGSIR
SDRFKYIQQLLIGIIRNLDLGQFMTRVGIIVFSDDAQLSIRLNDYWNMQDLITAIYKIVY
RGQRTNTAAALNLLRTQAFTATNGDRSGVPNVAIIVSDGNSNINPSSTVDEAIACRQAGI
RLVTASLGDSINMAEIKNIASFPIEFNAYNVTNYTLVDNLIQLAVQSTCDSNNKCQSNTC
QNGGTCVPLFNFYQCKCPRFYAGVNCERNCTVRSDVTIVLDFSGSIGYMEDWYNMLVSFA
REVINGLDVDNDVARVAVVAYATDVIKTIYFNEYANNRAKLLEALAFYYAGGTTNTQAAL
SFVASSVFDANRGYRGFDSGVLKSVILLSDGESNVQAENTVPAANSLKRLGARVYSVIVG
TDFNAAEMERISSNGTMYTYRMPHMADVKKVASQFLNDNCRV
Download sequence
Identical sequences T1EDJ5
XP_009029885.1.102002 jgi|Helro1|104083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]