SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009030448.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009030448.1.102002
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-31
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009030448.1.102002
Sequence length 98
Comment hypothetical protein HELRODRAFT_147387, partial [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
GVITSPNYPNNYPNKLDCKFSIEAPDGATITITFQEFSIEAESDCSFDRLEFIDPLSDNT
KLYCGSTLPPPVISKGNKVSFLFSTDSNVNNGNFKITY
Download sequence
Identical sequences T1EJZ7
jgi|Helro1|147387 XP_009030448.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]