SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009031614.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009031614.1.102002
Domain Number 1 Region: 725-856
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-19
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 379-466
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000109
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 563-673
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000746
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 4 Region: 151-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000288
Family FCH domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009031614.1.102002
Sequence length 893
Comment hypothetical protein HELRODRAFT_166445 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MASKSFGISNSIGKANSSGIQNSFGNLSSAGFGISNRLGIGTTSGTAPGIFGKSTCFLLT
FIGDLDEIVKQNNNNNINNINNININNINNNNNNNINNNNIIILYNNININNSCSNYLNL
YLNLERPEIVDPNSFNAKICSLQHQQQHRQQQLQQQQQQQSQQHRQQQQHQLLRQQYYHS
QQHQEKHLDQNIQQHQQQMQQQQYEKQQHWYQLQQNQLRLDQQHQQQQHQQQQHQQQHQQ
QHQQQHQQQQHQQQQHQQQHQQQHQQQHQQQQHQQHSKPLIFYSSERSLIIELHTELYQN
NNNNNKINNNNNISNNNNNKNNNNNSNNNNNINNSNTNNVQFSVSYAFIDKSQFEMTSGT
KRRHEFCTYDFYSTRNSKAGKFYSPGYPQPYRINYNCSYVFHALDKERILIKFAFIRLLR
SSLTSSSHLASCDGGVFCGLEGERKTVTSLSEKMVVVLISAGSSNKHGEKSGGGKYWVTG
GDDGDGGDFGGEGFEITYQFINEDDAVLLHDAQSNHHRTENLLSNISSSSSSSPSQWSSS
SPPSSSSSSSSSGCTREYLSVQSKSGSVLSPSYPSSSVANLTCRYIFRGHGNERVQILLE
EFHGIMGNSINNNNQHNNECSERDDRLLVTSFISGHHRPVSVLCAGSHVTSKSLPIMSSD
NQLELIYITTSAENKMAADGSSNSSNSGASSSSNRGSGTGRRFKVNYSFVTDFGIKTGVQ
DVNKGCDFKFPSRLNKNGSLSSPNHPGHYPRNVHCTYTFAGLDDERVEIRFHHFHIEGVA
PSCLADTQSDYLELQFSPTPPIDDDDAGSGSRYCGKGLPLTSGNSSALFSEGPYLLMTFI
SNDVYDATGFSASYYFWKKRKDVTNQRKRIVPFVSPQTAIFEHWLEFITRTTT
Download sequence
Identical sequences T1EY53
XP_009031614.1.102002 jgi|Helro1|166445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]