SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009044281.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009044281.1.39240
Domain Number - Region: 117-181
Classification Level Classification E-value
Superfamily Prefoldin 0.00353
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009044281.1.39240
Sequence length 208
Comment hypothetical protein LOTGIDRAFT_155994 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MNTSSDLSSKSEGETATKARSSSINSPERSSLTLSSPRIPGRDQSGANPMPVNDKRPYVA
RDKHKQSTDTTNHKADLKIEKGCLMSATNGDEVRLPKPPKAEVGQDAGVRRSECFRNYLH
TSANEIQRCQASLQKSLHNKTLNVAYIKYLEKNQEALNKAIDNFEKRKTNVNRQLRDEER
VSSRTSKMKFLHRLSKMFIKNREIKSHN
Download sequence
Identical sequences V4BFU6
jgi|Lotgi1|155994|fgenesh2_pg.C_sca_10000027 XP_009044281.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]