SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009045016.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009045016.1.39240
Domain Number 1 Region: 116-348
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-65
Family Nuclear receptor ligand-binding domain 0.000035
Further Details:      
 
Domain Number 2 Region: 9-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-29
Family Nuclear receptor 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009045016.1.39240
Sequence length 354
Comment hypothetical protein LOTGIDRAFT_136477, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
ISEFDGETVLCRVCGDKASGFHYGVHACEGCKGFFRRSIQQKIQYRPCLKNQQCNIMRVN
RNRCQYCRLKKCISVGMSRDAVRFGRVPKKEKARIIEQMQKVSSQSTSSAILSILSNEQD
VVQAVFNAHRQTCDFSQFRVQQMRELAFQDNKYVDCPTHMACPLNNQLGMDPNANKDWEN
FSESFTPAIKSVVDFAKGIPGFTLLNQDDQVTLLKAGTFEVLLVRLSCLFDPDTNTLMFT
GGRLNCVLVFQISCGAGFLLDSMFDFAERFNKLNLGDEELALFSAIVLLSPDRPGLRNLE
QVEKIQNALTESLHNIININYKEDNTMFAKLLMKTTDLRTLNTLHSEKSIGRYN
Download sequence
Identical sequences V4AJF3
jgi|Lotgi1|136477|e_gw1.106.5.1 XP_009045016.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]