SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009045563.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009045563.1.39240
Domain Number 1 Region: 431-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000694
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  XP_009045563.1.39240
Domain Number - Region: 122-209
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0471
Family Tricorn protease N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009045563.1.39240
Sequence length 860
Comment hypothetical protein LOTGIDRAFT_171136 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MEMRNFLKFLILWCLPLCRGLGLDQWGNHFYLSFLVNVQNSDYIYLNVIVITTREQTTVR
INLNKLNTPVTEITLAPGQSYNLVLDESYKAVPVLEVIPKKAVVITSSAPVSVYGFTGRQ
TSNEGYLTLPVPSLGKQYIVVNYENGRPQIVVIAIEDGTTVTITLKGDNKCFYINGFKDY
VDGYAFTFTMNDADVVNIYCLYDSTGSIVASNKPVAMLSGNRCADIPSQSRCDHLVEMLP
PVSELGTKFIVVAPDFQTYNAAMRVVATQSSTTFTIKGIDYVLGNSDFQELSLIKGEVVC
FTSNKPVLVVVYMGGKDVDNGIDTYYHGDPLMMVVPPVDKYTTQYVMDSAQLNYNNIYAI
LVSQKESTNLITPSVTSGWSDVCSDHAYVIKSVSGFVSYESSDSLMVWMYGTEIRGGFGF
PGGFGLSDYSGVNECATNPCQNDGWCLEVGTTTRCNCGLEYTGSLCETVITTTAEPSTTT
EPSTTTEPSTTTEPTTTTEPTTTTEPTTTTEPSTTTEPTSTTEPTTTTEPTTTTEPTTTT
EPTTTTEPITTTEPTTTTEPTTTTEPTTTTVPTTTTEPSTTTEPTTTTEPTTTTEPTTTT
EPTTTTEPTTTTELTTTTEPTTTTETTTTTEPTTTTEPTTAEPTTSTEPTTTTEPNTTTE
PNTTTEPTTEPTASTEPTTTTEPNTTTEPNTTTEPNTTTEPTTEPTASAEPTTTTGATTT
TELTTTTELTTDEANFKPIFHKPCKLGSCQCACPCKIGTVTKLERVQNASKQIAKKLILP
KQTLSKTKRTKTSVYNTNQTEETLGISSFVFLGLFLLVFLLLDIPVNRIVNWIQMIGSGR
TRKRLNQANDSNHRRQYVSD
Download sequence
Identical sequences V4B7V9
jgi|Lotgi1|171136|fgenesh2_pg.C_sca_110000002 XP_009045563.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]