SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009045984.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009045984.1.39240
Domain Number 1 Region: 8-317
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.37e-84
Family Bee venom hyaluronidase 0.00000184
Further Details:      
 
Weak hits

Sequence:  XP_009045984.1.39240
Domain Number - Region: 372-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0436
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009045984.1.39240
Sequence length 393
Comment hypothetical protein LOTGIDRAFT_83086, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
PKLEPTKPFSVFWNVPSFVCESRTPFNFTGSGITHNAKDAFIGDEDAIFYNLGLFPHLGN
PNVNGGIPQLGDLAKHLIMVESNVLKLLPNPMFHGAGIIDMESWRPIWVTNFSSLRKYQS
ASINLVKQQHPSWTNKTQINSEAEKQFETSARSFMLRSIEKVRQLRPQGYYGYYGYPRCW
GRPTGLDKTCPIGITSQINDKLGWLFSASNALYPRIYFNPVANSQDSIHNDIRRILNETA
RVQAKFSGLDAPILPYAVFQSGLHFFNETDLDLAIREPADMGAAGVVFWGSSSMFHIPNE
CAKMNDYIQHVLGPYIIKTEKFFQNCTQVNCNGHGRCIRKDYFQMAQENLRDGDHCKLKE
EEMKEIGNNKSNANEFKASYACRCFDGWKGSKC
Download sequence
Identical sequences V4B6Z6
jgi|Lotgi1|83086|gw1.116.72.1 XP_009045984.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]