SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009046143.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009046143.1.39240
Domain Number 1 Region: 249-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000762
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009046143.1.39240
Sequence length 358
Comment hypothetical protein LOTGIDRAFT_237823 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MGFQVGLCELGPWNEWCEDNVKIASYLTPFKFFGTDKRRAKIYAQMNFYKQFPQPPLKQL
HKRVTAACDKGVVPCMVEIKNTAVQSRAFQPSVGQFHPFPTELEEFQYKLSASYYMCYFT
VNRKSSLRHILAGANCLEKIQGSGLIQDFTSNPKYFTLRDVRTDQVPFQCAELFYCPEPC
YALSSHGLMSYYYDKDTDTSNPCHDIEYNKECKWMEGANTDIYSLMAGKFNFTCNCQEGT
ESGYEWNLKYKICVDVDECFTKQATCPRNQLCINTKGSYFCHCKRGFKYNAARNICEEDN
SVINFAELRKKKKIKSSEMTFRKQLEILIGLRSSIVIVKPSLIVNIFAVFICFQVLLY
Download sequence
Identical sequences V4CLN6
jgi|Lotgi1|237823|estExt_fgenesh2_pg.C_sca_1180070 XP_009046143.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]