SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009048264.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009048264.1.39240
Domain Number 1 Region: 35-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000339
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  XP_009048264.1.39240
Domain Number - Region: 123-179
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0377
Family Anti-platelet protein 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009048264.1.39240
Sequence length 199
Comment hypothetical protein LOTGIDRAFT_238373 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MCSGENNKTKRCQCKKGYKMSLDIDCTSNGSVFSCQDIDECATNNGSCEYKCQNEPGSYN
CSCPEGSELQGNGLNCGPSGPGPCMFENATVTGVSINFNRIYIGRENETECERRCNTTVG
CTDWLRAFEFCRNYGLPILQFEFLSIRSVDMCKKLCAQNKKCVTAQFREACTLYDSKQTE
FVDDGEPQTVLHKIDRNCT
Download sequence
Identical sequences V4AAJ8
XP_009048264.1.39240 jgi|Lotgi1|238373|estExt_fgenesh2_pg.C_sca_1430001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]