SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009048458.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009048458.1.39240
Domain Number 1 Region: 84-120,150-352
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.98e-37
Family Nuclear receptor ligand-binding domain 0.00059
Further Details:      
 
Domain Number 2 Region: 31-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.66e-23
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009048458.1.39240
Sequence length 365
Comment hypothetical protein LOTGIDRAFT_238472 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MPIQYFNRSNPWQFYKKCADASKSVPPGGHILCRVCGDKASGFHYGVFSCEGCKGFFRRT
IRQNITYKPCGNMKGCLIMRISRNRCQFCRLNKCVSVGMSHESVRLGRCPKKDRPASNSF
FVLPQNQSGAVDIDKQVKTEQMILSIHDAFKLAVKEFDRVAFELSPSEIVKLQSKEDSQN
IYVRYLPCIVKCITTFAKEIPQFLDLSLDEQRLLVKGCLLEVAAIHDSTHILHSEEKWED
EKLKFRLDTKHWNEYGLLGEVFHHMYDVVGKLRKYELTDVELSLLCAMVLFCPDREGLKT
VKMLENLEMDLSMALKCQLLLNHGNGSMLFVRCIETVVALRTITTKYLDKLLDAHVLLDM
TNSIA
Download sequence
Identical sequences V4CFN8
XP_009048458.1.39240 jgi|Lotgi1|238472|estExt_fgenesh2_pg.C_sca_1470004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]