SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009049166.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009049166.1.39240
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.84e-33
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 192-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009049166.1.39240
Sequence length 239
Comment hypothetical protein LOTGIDRAFT_141314 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MFVILTRSCLGFNLDGSPGSYAKFDHWEPCINGSLSFEFKTDRPNALLFYIDDGHSSFFE
LKLVAGIARLRLNLGDGTVILSAGQSLNDQQWHKVEIRRDGEQTTLTVDKIEHTRTLHGN
KFDTNNITDLYFFIGGLPNDYDQKLTSLALPSVVFEPKFRGSIRNLFYSSCAGPVERPTM
INHDGILSSDEDLCERGNPCLNGGMCLTTDDGLMCDCTRLEFEGDRCEIGELYFNFFIF
Download sequence
Identical sequences V4CDV7
XP_009049166.1.39240 jgi|Lotgi1|141314|e_gw1.159.35.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]