SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009049572.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009049572.1.39240
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000447
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  XP_009049572.1.39240
Domain Number - Region: 109-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0002
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 35-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000232
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 80-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009049572.1.39240
Sequence length 136
Comment hypothetical protein LOTGIDRAFT_96390, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
PCLNGGSCQPKSESFDDYYSCKCTDGWVGSRCQDDYDECTSSPCSWPYVCYNYENRYECA
CSQDEPDCDGLVASDAAYTCENYRRAESFDDYYSCKCTDGWVGSRCQDDYDECTSSPCSW
PYVCYNYENRYECACS
Download sequence
Identical sequences V4AXE5
jgi|Lotgi1|96390|gw1.164.24.1 XP_009049572.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]