SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009050376.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009050376.1.39240
Domain Number 1 Region: 210-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000132
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 136-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000822
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 3 Region: 62-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000947
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 97-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 173-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 19-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000292
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009050376.1.39240
Sequence length 314
Comment hypothetical protein LOTGIDRAFT_114238, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
TNFHCSCCDMFKGEYCHTFDSCLSRPCQNGGQCEHKKNSLSDFNCNCRLGYHDSLCTERV
SNLCSLDLCQNNGSCTGNQTHFQCECRPGFSGSHCEVDINECESNPCQHGVCVDRVGGFQ
CYCTPGYHGTKCNEMYNLCKTSPCQNEGVCIQEVDDYRCQCHPGHKGRHCTDKVDLCSPN
PCFNHSKCSYDYNATCHCPPGFKGTRCEVNVNECESSPCLNGGTCKDFINGFKCSCHELH
AGPNCEYTSKFVRKGNDLEGTNHSYHVENLYIVAGTLSGAILIVIIVLTTCYCRMHETYK
HCGLKRLQYSRQKE
Download sequence
Identical sequences V4CAA6
XP_009050376.1.39240 jgi|Lotgi1|114238|e_gw1.18.19.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]