SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009050634.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009050634.1.39240
Domain Number 1 Region: 268-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family Cripto EGF-like domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009050634.1.39240
Sequence length 366
Comment hypothetical protein LOTGIDRAFT_174061 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MYKVCLLVVFLAMSSAMGRHFPKKSLLDKRLLESENFKHLSRHVFRRLITNNSSIILVKN
MKNLKRPNGEITFNSENSVSVPILPKNTEMLKERSENPQKIKKILKQVASLNKKHGKRVY
RFVTIPTNFKRVSVEDVRIRKNNMVNRPNHSKSHRRVISKRNKKHIKKVNKLGKLNSGNT
RKHQVQIKRTKKAIKSKRRIRKHKKGKRVYRFIHSRKNDKLTRISDTTMARSTHTTMKTT
TSMFPETTTESFQEPGRKHNKRGSEITKSCGNIMHGVWFKNQCNICRCFNGLFHCLPSVS
QGCDQRQNAEYDRYFLYPIVSGMNPDFETPQFELPLSSAITIRSPITLALCVILSVLSAY
CNLYLW
Download sequence
Identical sequences V4ANF6
XP_009050634.1.39240 jgi|Lotgi1|174061|fgenesh2_pg.C_sca_180000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]