SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009050735.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009050735.1.39240
Domain Number 1 Region: 98-213
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000785
Family Pentapeptide repeats 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009050735.1.39240
Sequence length 223
Comment hypothetical protein LOTGIDRAFT_142694, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
LPSVAISCHQLLSVVISRYQLSSVAVSCYQLSSVPISCHQMLSVVISYYQLSSVALSCHQ
LLSVVISRYQLSSVAISCNQLLSVVISSYYVNIELCFISRVNIELCFISSVNIELCFISR
VNIELCFISSVNIELCFISRVNIELCFISSVNIELCFISRVNIELCFISSVNIELCFISR
VNIELCFISSVNIELCFISRVNIELCFISSVNIELCFISSVNI
Download sequence
Identical sequences V4A3S9
jgi|Lotgi1|142694|e_gw1.184.21.1 XP_009050735.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]