SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009051695.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009051695.1.39240
Domain Number 1 Region: 852-901
Classification Level Classification E-value
Superfamily G protein-binding domain 1.52e-19
Family Rabaptin-5 0.00081
Further Details:      
 
Domain Number 2 Region: 893-957
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.99e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  XP_009051695.1.39240
Domain Number - Region: 150-258
Classification Level Classification E-value
Superfamily Prefoldin 0.000811
Family Prefoldin 0.008
Further Details:      
 
Domain Number - Region: 601-687
Classification Level Classification E-value
Superfamily G protein-binding domain 0.00319
Family Rabaptin-5 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009051695.1.39240
Sequence length 971
Comment hypothetical protein LOTGIDRAFT_228394 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MTDVDDFGPLESADPVSNDELSKLKQQVATLEDREATLKQELENEFGQKRAKFKDLYLQK
EEELCTIKSKSAEYQETIQKLEKELEKVSGELEGVKTAAALSEVNKQEVIQSIQKQCQQE
IASLQGLLNEAADEATTSMAARYDIERSKLVDLTGRYEEEIQELRSRLGHERTISTGSES
FLTSISKSLKRVGGSLPMPASPGSISNTSLEHNENLEDSMKKAKEDAEVLKSVVLPLEKE
IASLRDQLEQSQKKLAEMQNGDIINGEDRKSPSLPDLEDLSTGEDKVNQLVRYLKAEKAA
RKDLEMFVTVLTTQKNVLNEDTEKVRKELDEVCALLEEEKSNHDSLKQTWQMANDQFLES
QRLMMMDMRRIEGVLSQEQQRQIAELQKLDSDREAQEKKVRELEEAREKQEKQQAEKRRK
ISEERNKLTDINLQKTKDGLDKSKSQSKASLDSTNSDEVDLIDSEVHPSLSTSELSLLSE
DKFLDSGIHDTRSLSDLDTTTTVRISPDKVLNLPTLTEAQMKAITDLTPEVEARKSLLAV
AKSKSDNLSLEGKRLVSEREWKLLQQEMKTSREKLGRPCHMCTNYEAQLQTVQTEFKEAT
SEAQKLDRHLKSEKTASENQQKYIAELEEAIKTKADEVFGLISSLQNKLSESEKYLVQTK
QQSVQSQLQLQDQLKTLTESRQEVQKELNKLQEENESLMGKHSKTAQQLQNEDINLPDNM
EEMQLLLLKYREEIIAAKVAKEHLEDTLRSEILFLKDQVVSEQQEKNNIEETLTQEIHGL
QEKQACFESIQSELERESAVRAEFETKFRENELALKNLQAKNKQLISVLQQRVEEFDKAK
VKFEEESQASRSKIQSLQIDLDNSEAVQRDFVKLSQSLQIQLEKIRQAENEVRWQHEDDV
DECMNCKQVFSVTKRKHHCKHCGKIFCNDCITKTVASGRNLRASKVCDVCHTILVKDATP
YFCTEPPASPD
Download sequence
Identical sequences V4C831
XP_009051695.1.39240 jgi|Lotgi1|228394|estExt_fgenesh2_pg.C_sca_20372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]