SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009052241.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009052241.1.39240
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000551
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009052241.1.39240
Sequence length 120
Comment hypothetical protein LOTGIDRAFT_239219 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MNYLFFSAILIASTATIYAQVNVPQCAGFQCISGTCNITVAGVPFCQCFTGFKPSNIISV
CEDIDECKQNNQLCQGFYCCNEPGAYTCSAHPCNQRNFNRRNDLSSLFFLLPFLGEAKKK
Download sequence
Identical sequences V4AJ36
jgi|Lotgi1|239219|estExt_fgenesh2_pg.C_sca_2070017 XP_009052241.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]