SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009055191.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009055191.1.39240
Domain Number 1 Region: 127-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000548
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 3-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000274
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  XP_009055191.1.39240
Domain Number - Region: 59-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000102
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 97-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000433
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 33-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009055191.1.39240
Sequence length 173
Comment hypothetical protein LOTGIDRAFT_118680, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
CPTPCLNSGVCESNGRCRCILGYKGDHCQHAICKEGCKNGGRCVSPGKCECPVGFSGPDC
KPYCAQTCHNGGECVRTNVCKCPKGYTGADCSQPVCSLGCFNGGKCVAPEKCSCPRGYRG
QYCHKAKCRSKCLNKGKCVSPNTCLCRKGYSGPRCEHCKYLSHSISFQLLHNP
Download sequence
Identical sequences V4ALA0
XP_009055191.1.39240 jgi|Lotgi1|118680|e_gw1.29.177.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]