SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009058791.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009058791.1.39240
Domain Number 1 Region: 78-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000758
Family EGF-type module 0.023
Further Details:      
 
Domain Number 2 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000224
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 40-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 2-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009058791.1.39240
Sequence length 166
Comment hypothetical protein LOTGIDRAFT_123205, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
DACTNDPCYNAGTCQLDHSLGFRCLCPLGKTGTLCECGNNPCKSMPCHNGATCIMLDTVN
YQCLCQDGYRGLNCEELTDPCASQPCQYGGTCDRFLEEDTFYCTCPDGRMGLRCEKEYDG
APCNVNPCQNGGVCQPMLNHADCKCPSNFMGEKCNKSKCLVKIINV
Download sequence
Identical sequences V4A1E0
XP_009058791.1.39240 jgi|Lotgi1|123205|e_gw1.43.226.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]