SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009060420.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009060420.1.39240
Domain Number 1 Region: 2-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 2 Region: 83-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 3 Region: 41-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009060420.1.39240
Sequence length 120
Comment hypothetical protein LOTGIDRAFT_75648, partial [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
VQQCKPTEFRCASGDCVEGSYRCDGQIDCIDNSDEIGCSNICKDEEFKCRSGDCIDIFLI
CNGRIECPDGSDEDDCPVGPSGTCRDDEFRCIDGTCINFNFRCDSRSDCPDGDDEFGCRK
Download sequence
Identical sequences V4BJY3
XP_009060420.1.39240 jgi|Lotgi1|75648|gw1.50.131.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]