SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009060652.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009060652.1.39240
Domain Number - Region: 135-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0661
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009060652.1.39240
Sequence length 540
Comment hypothetical protein LOTGIDRAFT_234473 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MAIEKRRGKQREKREKENNLDEVKLLFLISAICRGRSDSTACSKYFPYSHIVLADKTTVN
RSVGKCIRPDVCECKQVGFYSAGSFCDICSPINNCDLEYCTTKTDQKCRKCEGLVQDRPG
YRAYILSADKRSCEKACSWRPDSRCYPGTCRDELFSNCGCKDGFTGSYCQRITAIPDILY
NQVTLTADNGETVDAPGDFGSGSPQPLTWTNIMKPKDLYYSFRSNYYKPSPTRPPFVVDY
KVGIIDGRIRFTKYGRNGVQTQTTSCSTISKDNPNQGIFDCTKTIQPTFSVPFQHLERLS
FKITTSIGGFVKIKDLERNVYNTYYYTPNSLSREYEIKFDNVPPYHCQTVNNCNKTMLTD
IDILKKAENTVYWDHWVDDDSGIAIYELEIFSLKSVGNELMIDKRTFNTKTTLKNQRFNV
PLPGVYSVILAVVDKAGNVRLTRRCLIFEDKNHVSTVQNTNLTPTSALPSTNYTWQQKHG
PVTIDWENRYVNTKHHNGKYLAGIQDYHGLVSEYDDHYGTRTTKPIDNFQVSANFCKAHI
Download sequence
Identical sequences V3ZC28
XP_009060652.1.39240 jgi|Lotgi1|234473|estExt_fgenesh2_pg.C_sca_510065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]