SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009060989.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009060989.1.39240
Domain Number 1 Region: 343-497
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.23e-36
Family Toll/Interleukin receptor TIR domain 0.00013
Further Details:      
 
Domain Number 2 Region: 99-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000154
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  XP_009060989.1.39240
Domain Number - Region: 54-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 154-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000384
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 219-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0304
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 252-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0594
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009060989.1.39240
Sequence length 568
Comment hypothetical protein LOTGIDRAFT_165708 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MWRRLDKNICYHVPLANGTIYYGVIEAGFNFDFSGNTPPPSNNNCAQITNYCILPTYCLH
NGQCSFNTTLCETNCHCPSPYTGKRCREKLCPDGCGGNTTLCLNGGSCTINKDTCQQQCV
CPEGYTGINCESNIQVTNDTETDQECPMNLCDSFAFCYKGICKQNKRTCAPYCICEDGFT
GSQCETFIDSSDTTTASTPSIPSTSLAPLALRQCASGFTCKHGICDQEKLKENRFKCNCD
KGFIGTTCRKPCRVDCGEYGHCYLDGLKERCACHPDWVGENCTDPKPTPATLIAPANAGW
VWWVAGSCIGLLVLLVFLLIVLPVWLWKRREIFIMKIVHYMQPYEDSDGKMFDAFISYKS
HPDDEGFVLNHVFQKLEKELGFKLCLHFRDFKVGETIANNILWAVENSRRTVLIISPNYL
GSEYAQFEFQTAHLESLSLHSRIVPVIYKDISQHQGSIDATLKHILRTITYLEWPTIEDN
KKETKFWKRLALSLPKRKELDAKSIEAKLSPSKDHSDNHINLLSYKTLNSKSTETMWTDV
SLDETKDTGNYHKNLVSNSGDVSLNMTE
Download sequence
Identical sequences V4A021
XP_009060989.1.39240 jgi|Lotgi1|165708|fgenesh2_pg.C_sca_53000051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]